Lineage for d2iy5b6 (2iy5 B:475-681)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730673Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 730799Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 730800Species Thermus thermophilus [TaxId:274] [55704] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 730808Domain d2iy5b6: 2iy5 B:475-681 [137799]
    Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5
    automatically matched to d1b70b5
    complexed with fya, mg

Details for d2iy5b6

PDB Entry: 2iy5 (more details), 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOP Domain Sequences for d2iy5b6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy5b6 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnraveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaeafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOP Domain Coordinates for d2iy5b6:

Click to download the PDB-style file with coordinates for d2iy5b6.
(The format of our PDB-style files is described here.)

Timeline for d2iy5b6: