| Class b: All beta proteins [48724] (176 folds) |
| Fold b.153: PheT/TilS domain [56036] (1 superfamily) core: 3 layers; contains beta-sandwich of unusual topology |
Superfamily b.153.1: PheT/TilS domain [56037] (2 families) ![]() contains putative tRNA-binding structural motif |
| Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) Pfam PF03483; decorated with additional structures |
| Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
| Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d2iy5b4: 2iy5 B:191-399 [137797] Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b5, d2iy5b6 automatically matched to d1b70b6 protein/RNA complex; complexed with fya, mg |
PDB Entry: 2iy5 (more details), 3.1 Å
SCOPe Domain Sequences for d2iy5b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy5b4 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk
Timeline for d2iy5b4: