Lineage for d2iy5b4 (2iy5 B:191-399)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1143005Fold b.153: PheT/TilS domain [56036] (1 superfamily)
    core: 3 layers; contains beta-sandwich of unusual topology
  4. 1143006Superfamily b.153.1: PheT/TilS domain [56037] (2 families) (S)
    contains putative tRNA-binding structural motif
  5. 1143007Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
    Pfam PF03483; decorated with additional structures
  6. 1143008Protein B3/B4 domain of PheRS, PheT [56039] (1 species)
  7. 1143009Species Thermus thermophilus [TaxId:274] [56040] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1143017Domain d2iy5b4: 2iy5 B:191-399 [137797]
    Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b5, d2iy5b6
    automatically matched to d1b70b6
    protein/RNA complex; complexed with fya, mg

Details for d2iy5b4

PDB Entry: 2iy5 (more details), 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2iy5b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy5b4 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

SCOPe Domain Coordinates for d2iy5b4:

Click to download the PDB-style file with coordinates for d2iy5b4.
(The format of our PDB-style files is described here.)

Timeline for d2iy5b4: