| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.4: Myf domain [50277] (7 proteins) |
| Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
| Species Thermus thermophilus [TaxId:274] [50279] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d2iy5b3: 2iy5 B:39-151 [137796] Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b4, d2iy5b5, d2iy5b6 automatically matched to d1b70b3 protein/RNA complex; complexed with fya, mg |
PDB Entry: 2iy5 (more details), 3.1 Å
SCOPe Domain Sequences for d2iy5b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy5b3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d2iy5b3: