Lineage for d2iy5b3 (2iy5 B:39-151)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789623Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 2789633Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 2789634Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2789645Domain d2iy5b3: 2iy5 B:39-151 [137796]
    Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b4, d2iy5b5, d2iy5b6
    automatically matched to d1b70b3
    protein/RNA complex; complexed with fya, mg

Details for d2iy5b3

PDB Entry: 2iy5 (more details), 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2iy5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy5b3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d2iy5b3:

Click to download the PDB-style file with coordinates for d2iy5b3.
(The format of our PDB-style files is described here.)

Timeline for d2iy5b3: