Lineage for d2iy5b2 (2iy5 B:400-474)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309714Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2309715Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2309716Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 2309717Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 2309718Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2309734Domain d2iy5b2: 2iy5 B:400-474 [137795]
    Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6
    automatically matched to d1b70b2
    protein/RNA complex; complexed with fya, mg

Details for d2iy5b2

PDB Entry: 2iy5 (more details), 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2iy5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy5b2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariegyetipl

SCOPe Domain Coordinates for d2iy5b2:

Click to download the PDB-style file with coordinates for d2iy5b2.
(The format of our PDB-style files is described here.)

Timeline for d2iy5b2: