![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) duplication: contains two such domains related by pseudo dyad |
![]() | Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46958] (9 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d2iy5b2: 2iy5 B:400-474 [137795] Other proteins in same PDB: d2iy5a1, d2iy5a2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6 automatically matched to d1b70b2 protein/RNA complex; complexed with fya, mg |
PDB Entry: 2iy5 (more details), 3.1 Å
SCOPe Domain Sequences for d2iy5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy5b2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl veevariegyetipl
Timeline for d2iy5b2: