Lineage for d2iy5a2 (2iy5 A:85-350)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663709Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1663834Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1663835Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1663844Domain d2iy5a2: 2iy5 A:85-350 [137793]
    Other proteins in same PDB: d2iy5a1, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6
    automatically matched to d1eiya2
    protein/RNA complex; complexed with fya, mg

Details for d2iy5a2

PDB Entry: 2iy5 (more details), 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2iy5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy5a2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d2iy5a2:

Click to download the PDB-style file with coordinates for d2iy5a2.
(The format of our PDB-style files is described here.)

Timeline for d2iy5a2: