SCOP 1.73: Domain d2iy5a2: 2iy5 A:85-350

Lineage for d2iy5a2 (2iy5 A:85-350)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55702] (9 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2iy5a2: 2iy5 A:85-350 [137793]
   Other proteins in same PDB: d2iy5a1, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6
   automatically matched to d1eiya2
   complexed with fya, mg

Details for d2iy5a2

PDB Entry: 2iy5, 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog

PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOP Domain Sequences for d2iy5a2:

Sequence; same for both SEQRES and ATOM records:

>d2iy5a2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

Timeline for d2iy5a2:

• d2iy5a2 is new in SCOP 1.73
  
• d2iy5a2 appears in SCOP 1.75
  
• d2iy5a2 appears in the current release, SCOPe 2.08