![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d2iy5a2: 2iy5 A:85-350 [137793] Other proteins in same PDB: d2iy5a1, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6 automatically matched to d1eiya2 protein/RNA complex; complexed with fya, mg |
PDB Entry: 2iy5 (more details), 3.1 Å
SCOPe Domain Sequences for d2iy5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy5a2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d2iy5a2: