![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.7: tRNA-binding arm [46589] (5 families) ![]() formerly a class II aminoacyl-tRNA synthetase N-domain |
![]() | Family a.2.7.2: Phenylalanyl-tRNA synthetase (PheRS) [46593] (1 protein) automatically mapped to Pfam PF02912 |
![]() | Protein Phenylalanyl-tRNA synthetase (PheRS) [46594] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46595] (2 PDB entries) |
![]() | Domain d2iy5a1: 2iy5 A:15-84 [137792] Other proteins in same PDB: d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6 automatically matched to d1eiya1 protein/RNA complex; complexed with fya, mg |
PDB Entry: 2iy5 (more details), 3.1 Å
SCOPe Domain Sequences for d2iy5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy5a1 a.2.7.2 (A:15-84) Phenylalanyl-tRNA synthetase (PheRS) {Thermus thermophilus [TaxId: 274]} leelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaalearekalee aalkealere
Timeline for d2iy5a1: