SCOPe 2.03: Domain d2iy5a1: 2iy5 A:15-84

Lineage for d2iy5a1 (2iy5 A:15-84)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.7: tRNA-binding arm [46589] (4 families)
   formerly a class II aminoacyl-tRNA synthetase N-domain

5. Family a.2.7.2: Phenylalanyl-tRNA synthetase (PheRS) [46593] (1 protein)
   automatically mapped to Pfam PF02912

6. Protein Phenylalanyl-tRNA synthetase (PheRS) [46594] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46595] (2 PDB entries)

8. Domain d2iy5a1: 2iy5 A:15-84 [137792]
   Other proteins in same PDB: d2iy5a2, d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6
   automatically matched to d1eiya1
   protein/RNA complex; complexed with fya, mg

Details for d2iy5a1

PDB Entry: 2iy5, 3.1 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus complexed with trna and a phenylalanyl-adenylate analog

PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2iy5a1:

Sequence; same for both SEQRES and ATOM records:

>d2iy5a1 a.2.7.2 (A:15-84) Phenylalanyl-tRNA synthetase (PheRS) {Thermus thermophilus [TaxId: 274]}
leelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaalearekalee
aalkealere

Timeline for d2iy5a1:

• d2iy5a1 first appeared in SCOP 1.73
  
• d2iy5a1 appears in SCOPe 2.02
  
• d2iy5a1 appears in SCOPe 2.04
  
• d2iy5a1 appears in the current release, SCOPe 2.08