Lineage for d2iy3a2 (2iy3 A:89-305)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111930Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2111941Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)
  8. 2111969Domain d2iy3a2: 2iy3 A:89-305 [137791]
    Other proteins in same PDB: d2iy3a1
    automatically matched to d2ffha3
    protein/RNA complex

Details for d2iy3a2

PDB Entry: 2iy3 (more details), 16 Å

PDB Description: structure of the e. coli signal regognition particle
PDB Compounds: (A:) signal recognition particle protein ffh

SCOPe Domain Sequences for d2iy3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy3a2 c.37.1.10 (A:89-305) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdiesilekvk

SCOPe Domain Coordinates for d2iy3a2:

Click to download the PDB-style file with coordinates for d2iy3a2.
(The format of our PDB-style files is described here.)

Timeline for d2iy3a2: