SCOPe 2.08: Domain d2iy3a2: 2iy3 A:89-305

Lineage for d2iy3a2 (2iy3 A:89-305)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [102373] (3 PDB entries)

8. Domain d2iy3a2: 2iy3 A:89-305 [137791]
   Other proteins in same PDB: d2iy3a1
   automatically matched to d2ffha3
   protein/RNA complex

Details for d2iy3a2

PDB Entry: 2iy3

PDB Description: structure of the e. coli signal regognition particle

PDB Compounds: (A:) Signal recognition particle protein,Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d2iy3a2:

Sequence; same for both SEQRES and ATOM records:

>d2iy3a2 c.37.1.10 (A:89-305) GTPase domain of the signal sequence recognition protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdiesilekvk

Timeline for d2iy3a2:

• d2iy3a2 first appeared in SCOP 1.73
  
• d2iy3a2 appears in SCOPe 2.07