SCOPe 2.08: Domain d2iy3a1: 2iy3 A:1-88

Lineage for d2iy3a1 (2iy3 A:1-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [101121] (3 PDB entries)

8. Domain d2iy3a1: 2iy3 A:1-88 [137790]
   Other proteins in same PDB: d2iy3a2
   automatically matched to d2ffha1
   protein/RNA complex

Details for d2iy3a1

PDB Entry: 2iy3

PDB Description: structure of the e. coli signal regognition particle

PDB Compounds: (A:) Signal recognition particle protein,Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d2iy3a1:

Sequence; same for both SEQRES and ATOM records:

>d2iy3a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d2iy3a1:

• d2iy3a1 first appeared in SCOP 1.73
  
• d2iy3a1 appears in SCOPe 2.07