Lineage for d2iy1d1 (2iy1 D:15-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194772Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1194778Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries)
    Uniprot Q93068
  8. 1194784Domain d2iy1d1: 2iy1 D:15-92 [137789]
    Other proteins in same PDB: d2iy1a_, d2iy1c_
    automatically matched to d1tgzb_
    mutant

Details for d2iy1d1

PDB Entry: 2iy1 (more details), 2.46 Å

PDB Description: senp1 (mutant) full length sumo1
PDB Compounds: (D:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2iy1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy1d1 d.15.1.1 (D:15-92) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d2iy1d1:

Click to download the PDB-style file with coordinates for d2iy1d1.
(The format of our PDB-style files is described here.)

Timeline for d2iy1d1: