![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54242] (13 PDB entries) |
![]() | Domain d2iy1d1: 2iy1 D:15-92 [137789] automatically matched to d1tgzb_ mutant |
PDB Entry: 2iy1 (more details), 2.46 Å
SCOP Domain Sequences for d2iy1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy1d1 d.15.1.1 (D:15-92) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqtgg
Timeline for d2iy1d1: