Lineage for d2iy1d2 (2iy1 D:15-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933314Domain d2iy1d2: 2iy1 D:15-96 [137789]
    Other proteins in same PDB: d2iy1a_, d2iy1b3, d2iy1c_, d2iy1d3
    automated match to d2ckhb1
    mutant

Details for d2iy1d2

PDB Entry: 2iy1 (more details), 2.46 Å

PDB Description: senp1 (mutant) full length sumo1
PDB Compounds: (D:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2iy1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy1d2 d.15.1.0 (D:15-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgghstv

SCOPe Domain Coordinates for d2iy1d2:

Click to download the PDB-style file with coordinates for d2iy1d2.
(The format of our PDB-style files is described here.)

Timeline for d2iy1d2: