![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
![]() | Domain d2iy1d2: 2iy1 D:15-96 [137789] Other proteins in same PDB: d2iy1a_, d2iy1b3, d2iy1c_, d2iy1d3 automated match to d2ckhb1 mutant |
PDB Entry: 2iy1 (more details), 2.46 Å
SCOPe Domain Sequences for d2iy1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy1d2 d.15.1.0 (D:15-96) automated matches {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqtgghstv
Timeline for d2iy1d2:
![]() Domains from other chains: (mouse over for more information) d2iy1a_, d2iy1b2, d2iy1b3, d2iy1c_ |