Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries) Uniprot Q93068 |
Domain d2iy1b1: 2iy1 B:15-92 [137788] Other proteins in same PDB: d2iy1a_, d2iy1c_ automatically matched to d1tgzb_ mutant |
PDB Entry: 2iy1 (more details), 2.46 Å
SCOPe Domain Sequences for d2iy1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy1b1 d.15.1.1 (B:15-92) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqtgg
Timeline for d2iy1b1: