SCOPe 2.07: Domain d2ixqb1: 2ixq B:1-123

Lineage for d2ixqb1 (2ixq B:1-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam PF04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
   Uniprot Q57254 P24093 23-159

8. Domain d2ixqb1: 2ixq B:1-123 [137785]
   Other proteins in same PDB: d2ixqa1, d2ixqa2, d2ixqb2
   automatically matched to d1rxla_

Details for d2ixqb1

PDB Entry: 2ixq

PDB Description: the solution structure of the invasive tip complex from afa-dr fibrils

PDB Compounds: (B:) afimbrial adhesin afa-III

SCOPe Domain Sequences for d2ixqb1:

Sequence; same for both SEQRES and ATOM records:

>d2ixqb1 b.2.3.6 (B:1-123) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
wak

Timeline for d2ixqb1:

• d2ixqb1 first appeared in SCOP 1.73
  
• d2ixqb1 appears in SCOPe 2.06
  
• d2ixqb1 appears in the current release, SCOPe 2.08