Lineage for d2ixqb1 (2ixq B:1-133)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659391Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 659513Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 659514Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 659515Species Escherichia coli [TaxId:562] [110077] (6 PDB entries)
  8. 659539Domain d2ixqb1: 2ixq B:1-133 [137785]
    automatically matched to d1rxla_

Details for d2ixqb1

PDB Entry: 2ixq (more details)

PDB Description: the solution structure of the invasive tip complex from afa-dr fibrils
PDB Compounds: (B:) afimbrial adhesin afa-III

SCOP Domain Sequences for d2ixqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixqb1 b.2.3.6 (B:1-133) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
wakdnkqgftpsg

SCOP Domain Coordinates for d2ixqb1:

Click to download the PDB-style file with coordinates for d2ixqb1.
(The format of our PDB-style files is described here.)

Timeline for d2ixqb1: