Lineage for d2ixob_ (2ixo B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016427Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2016428Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2016429Family a.268.1.1: PTPA-like [140985] (2 protein domains)
    Pfam PF03095
  6. 2016448Protein automated matches [190724] (2 species)
    not a true protein
  7. 2016449Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187883] (3 PDB entries)
  8. 2016450Domain d2ixob_: 2ixo B: [137780]
    Other proteins in same PDB: d2ixoa1
    automated match to d2ixoa1

Details for d2ixob_

PDB Entry: 2ixo (more details), 2.6 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa1 ptpa1
PDB Compounds: (B:) serine/threonine-protein phosphatase 2a activator 1

SCOPe Domain Sequences for d2ixob_:

Sequence, based on SEQRES records: (download)

>d2ixob_ a.268.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey
hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphhrgadvfllfnkyy
timrrliltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvre
ykdtnfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevekkfpv
vqhfwfgtgffpwvni

Sequence, based on observed residues (ATOM records): (download)

>d2ixob_ a.268.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey
hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphhrgadvfllfnkyy
timrrliltytlepagsglddhfhlvyilgssqwqlldaqaplqpreildkslvreykdt
nfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevekkfpvvqhf
wfgtgffpwvni

SCOPe Domain Coordinates for d2ixob_:

Click to download the PDB-style file with coordinates for d2ixob_.
(The format of our PDB-style files is described here.)

Timeline for d2ixob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ixoa1