Lineage for d2ixoa1 (2ixo A:2-317)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016427Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2016428Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2016429Family a.268.1.1: PTPA-like [140985] (2 protein domains)
    Pfam PF03095
  6. 2016430Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 2016431Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140988] (3 PDB entries)
    Uniprot Q12461 2-317! Uniprot Q12461 3-299
  8. 2016432Domain d2ixoa1: 2ixo A:2-317 [137779]
    Other proteins in same PDB: d2ixob_

Details for d2ixoa1

PDB Entry: 2ixo (more details), 2.6 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa1 ptpa1
PDB Compounds: (A:) serine/threonine-protein phosphatase 2a activator 1

SCOPe Domain Sequences for d2ixoa1:

Sequence, based on SEQRES records: (download)

>d2ixoa1 a.268.1.1 (A:2-317) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey
hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphhrgadvfllfnkyy
timrrliltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvre
ykdtnfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevekkfpv
vqhfwfgtgffpwvni

Sequence, based on observed residues (ATOM records): (download)

>d2ixoa1 a.268.1.1 (A:2-317) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgygnlacrewhhklderlpqwlqemlpseyhev
vpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphhrgadvfllfnkyytim
rrliltytlepaglddhfhlvyilgssqwqlldaqaplqpreildkslvreykdtnfycq
ginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevekkfpvvqhfwfgtg
ffpwvni

SCOPe Domain Coordinates for d2ixoa1:

Click to download the PDB-style file with coordinates for d2ixoa1.
(The format of our PDB-style files is described here.)

Timeline for d2ixoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ixob_