Lineage for d2ixna1 (2ixn A:3-299)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754885Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 1754886Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 1754887Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 1754888Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 1754889Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140988] (3 PDB entries)
    Uniprot Q12461 2-317! Uniprot Q12461 3-299
  8. 1754891Domain d2ixna1: 2ixn A:3-299 [137777]
    Other proteins in same PDB: d2ixnb_

Details for d2ixna1

PDB Entry: 2ixn (more details), 2.8 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa2 ptpa2
PDB Compounds: (A:) serine/threonine-protein phosphatase 2a activator 2

SCOPe Domain Sequences for d2ixna1:

Sequence, based on SEQRES records: (download)

>d2ixna1 a.268.1.1 (A:3-299) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnllsqi
kditqkhpvikdadssrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyldes
wgnkrridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletkywl
epagshgvwglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciafin
kvkssaslrwhspmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpc

Sequence, based on observed residues (ATOM records): (download)

>d2ixna1 a.268.1.1 (A:3-299) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnllsqi
kditqkhpvikrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyldeswgnkr
ridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletkywlepags
hgvwglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciafinkvkss
aslrwhspmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpc

SCOPe Domain Coordinates for d2ixna1:

Click to download the PDB-style file with coordinates for d2ixna1.
(The format of our PDB-style files is described here.)

Timeline for d2ixna1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ixnb_