SCOPe 2.07: Domain d2ixlc_: 2ixl C:

Lineage for d2ixlc_ (2ixl C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Streptococcus suis [TaxId:1307] [89402] (4 PDB entries)

8. Domain d2ixlc_: 2ixl C: [137774]
   automated match to d1nzca_
   complexed with ni, trh

Details for d2ixlc_

PDB Entry: 2ixl, 1.6 Å

PDB Description: rmlc s. suis with dtdp-rhamnose

PDB Compounds: (C:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d2ixlc_:

Sequence; same for both SEQRES and ATOM records:

>d2ixlc_ b.82.1.1 (C:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
mtenffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegkl
qnnvsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksif
vprgvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevsead
enhpflkdvkplrkedl

Timeline for d2ixlc_:

• d2ixlc_ first appeared in SCOP 1.73, called d2ixlc1
  
• d2ixlc_ appears in SCOPe 2.06
  
• d2ixlc_ appears in the current release, SCOPe 2.08