SCOP 1.73: Domain d2ixlc1: 2ixl C:2-197

Lineage for d2ixlc1 (2ixl C:2-197)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (3 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Streptococcus suis [TaxId:1307] [89402] (4 PDB entries)

8. Domain d2ixlc1: 2ixl C:2-197 [137774]
   automatically matched to d1nzca_
   complexed with ni, trh

Details for d2ixlc1

PDB Entry: 2ixl, 1.6 Å

PDB Description: rmlc s. suis with dtdp-rhamnose

PDB Compounds: (C:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOP Domain Sequences for d2ixlc1:

Sequence; same for both SEQRES and ATOM records:

>d2ixlc1 b.82.1.1 (C:2-197) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]}
tenffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklq
nnvsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifv
prgvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseade
nhpflkdvkplrkedl

Timeline for d2ixlc1:

• d2ixlc1 is new in SCOP 1.73
  
• d2ixlc1 appears in SCOP 1.75
  
• d2ixlc1 appears in the current release, SCOPe 2.08, called d2ixlc_