Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species) synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase |
Species Mycobacterium tuberculosis [TaxId:1773] [101971] (3 PDB entries) |
Domain d2ixcb_: 2ixc B: [137766] automated match to d1upia_ complexed with trh |
PDB Entry: 2ixc (more details), 1.79 Å
SCOPe Domain Sequences for d2ixcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixcb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv rasgllprweqtqrfige
Timeline for d2ixcb_: