Lineage for d2ixca_ (2ixc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814472Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 2814473Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 2814477Species Mycobacterium tuberculosis [TaxId:1773] [101971] (3 PDB entries)
  8. 2814479Domain d2ixca_: 2ixc A: [137765]
    automated match to d1upia_
    complexed with trh

Details for d2ixca_

PDB Entry: 2ixc (more details), 1.79 Å

PDB Description: rmlc m. tuberculosis with dtdp-rhamnose
PDB Compounds: (A:) dtdp-4-dehydrorhamnose 3,5-epimerase rmlc

SCOPe Domain Sequences for d2ixca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixca_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]}
mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
rasgllprweqtqrfige

SCOPe Domain Coordinates for d2ixca_:

Click to download the PDB-style file with coordinates for d2ixca_.
(The format of our PDB-style files is described here.)

Timeline for d2ixca_: