![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein Feruloyl esterase A [102631] (1 species) Triacylglycerol lipase homologue |
![]() | Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries) Uniprot O42807 23-281 |
![]() | Domain d2ix9b_: 2ix9 B: [137764] automated match to d1uwca_ complexed with cxs, edo, so4 |
PDB Entry: 2ix9 (more details), 1.7 Å
SCOPe Domain Sequences for d2ix9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ix9b_ c.69.1.17 (B:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg qgvndahttyfgmtsgactw
Timeline for d2ix9b_: