Lineage for d2ix9b_ (2ix9 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508322Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 2508327Protein Feruloyl esterase A [102631] (1 species)
    Triacylglycerol lipase homologue
  7. 2508328Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries)
    Uniprot O42807 23-281
  8. 2508336Domain d2ix9b_: 2ix9 B: [137764]
    automated match to d1uwca_
    complexed with cxs, edo, so4

Details for d2ix9b_

PDB Entry: 2ix9 (more details), 1.7 Å

PDB Description: respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
PDB Compounds: (B:) feruloyl esterase a

SCOPe Domain Sequences for d2ix9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ix9b_ c.69.1.17 (B:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

SCOPe Domain Coordinates for d2ix9b_:

Click to download the PDB-style file with coordinates for d2ix9b_.
(The format of our PDB-style files is described here.)

Timeline for d2ix9b_: