SCOP 1.73: Domain d2ix9b1: 2ix9 B:1-260

Lineage for d2ix9b1 (2ix9 B:1-260)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (4 proteins)

6. Protein Feruloyl esterase A [102631] (1 species)
   Triacylglycerol lipase homologue

7. Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries)

8. Domain d2ix9b1: 2ix9 B:1-260 [137764]
   automatically matched to d1uwca_
   complexed with cxs, edo, so4

Details for d2ix9b1

PDB Entry: 2ix9, 1.7 Å

PDB Description: respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a

PDB Compounds: (B:) feruloyl esterase a

SCOP Domain Sequences for d2ix9b1:

Sequence; same for both SEQRES and ATOM records:

>d2ix9b1 c.69.1.17 (B:1-260) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

Timeline for d2ix9b1:

• d2ix9b1 is new in SCOP 1.73
  
• d2ix9b1 appears in SCOP 1.75
  
• d2ix9b1 appears in the current release, SCOPe 2.08, called d2ix9b_