Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
Protein Feruloyl esterase A [102631] (1 species) Triacylglycerol lipase homologue |
Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries) Uniprot O42807 23-281 |
Domain d2ix9a_: 2ix9 A: [137763] automated match to d1uwca_ complexed with cxs, edo, so4 |
PDB Entry: 2ix9 (more details), 1.7 Å
SCOPe Domain Sequences for d2ix9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ix9a_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg qgvndahttyfgmtsgactw
Timeline for d2ix9a_: