Lineage for d2ix4b2 (2ix4 B:301-461)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711305Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 711480Protein Beta-ketoacyl-ACP synthase II [53909] (5 species)
  7. 711510Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [117749] (2 PDB entries)
  8. 711514Domain d2ix4b2: 2ix4 B:301-461 [137762]
    automatically matched to d1w0ia2
    complexed with 6na, k

Details for d2ix4b2

PDB Entry: 2ix4 (more details), 1.95 Å

PDB Description: arabidopsis thaliana mitochondrial beta-ketoacyl acp synthase hexanoic acid complex
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOP Domain Sequences for d2ix4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ix4b2 c.95.1.1 (B:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]}
yaelcgygmsgdahhitqppedgkgavlamtralrqsglcpnqidyvnahatstpigdav
earaiktvfsehatsgtlafsstkgatghllgaagaveaifsilaihhgvapmtlnvknp
dpifdkrfmplttskkmlvrtamsnsfgfggtnasllfasi

SCOP Domain Coordinates for d2ix4b2:

Click to download the PDB-style file with coordinates for d2ix4b2.
(The format of our PDB-style files is described here.)

Timeline for d2ix4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ix4b1