SCOPe 2.08: Domain d2ix4b1: 2ix4 B:31-300

Lineage for d2ix4b1 (2ix4 B:31-300)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species)

7. Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [419496] (2 PDB entries)
   Uniprot Q8L3X9

8. Domain d2ix4b1: 2ix4 B:31-300 [137761]
   Other proteins in same PDB: d2ix4a2, d2ix4b2
   automated match to d1w0ia1
   complexed with 6na, k
   has additional insertions and/or extensions that are not grouped together

Details for d2ix4b1

PDB Entry: 2ix4, 1.95 Å

PDB Description: arabidopsis thaliana mitochondrial beta-ketoacyl acp synthase hexanoic acid complex

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2ix4b1:

Sequence; same for both SEQRES and ATOM records:

>d2ix4b1 c.95.1.1 (B:31-300) Beta-ketoacyl-ACP synthase II, N-terminal domain {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]}
rrvvvtglgmvtplgrgvettwrrlidgecgirgltlddlkmksfdeetklytfdqlssk
vaafvpygsnpgefdealwlnskavanfigyavcaadealrdaewlpteeeekertgvsi
gggigsicdiveaaqlicekrlrrlspffipkilvnmasghvsmkygfqgpnhaavtaca
tgahsigdatrmiqfgdadvmvaggtessidalsvagfsrsralstkfnsspqeasrpfd
cdrdgfvigegsgvivleeyehakrrgaki

Timeline for d2ix4b1:

• d2ix4b1 first appeared in SCOP 1.73
  
• d2ix4b1 appears in SCOPe 2.07