Lineage for d2ix4a1 (2ix4 A:31-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916692Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species)
  7. 2916714Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [419496] (2 PDB entries)
    Uniprot Q8L3X9
  8. 2916715Domain d2ix4a1: 2ix4 A:31-300 [137759]
    Other proteins in same PDB: d2ix4a2, d2ix4b2
    automated match to d1w0ia1
    complexed with 6na, k

    has additional insertions and/or extensions that are not grouped together

Details for d2ix4a1

PDB Entry: 2ix4 (more details), 1.95 Å

PDB Description: arabidopsis thaliana mitochondrial beta-ketoacyl acp synthase hexanoic acid complex
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2ix4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II, N-terminal domain {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]}
rrvvvtglgmvtplgrgvettwrrlidgecgirgltlddlkmksfdeetklytfdqlssk
vaafvpygsnpgefdealwlnskavanfigyavcaadealrdaewlpteeeekertgvsi
gggigsicdiveaaqlicekrlrrlspffipkilvnmasghvsmkygfqgpnhaavtaca
tgahsigdatrmiqfgdadvmvaggtessidalsvagfsrsralstkfnsspqeasrpfd
cdrdgfvigegsgvivleeyehakrrgaki

SCOPe Domain Coordinates for d2ix4a1:

Click to download the PDB-style file with coordinates for d2ix4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ix4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ix4a2