SCOP 1.75: Domain d2iwga2: 2iwg A:340-443

Lineage for d2iwga2 (2iwg A:340-443)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (28 PDB entries)
   Uniprot P01857 #118-327
   Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d2iwga2: 2iwg A:340-443 [137753]
   Other proteins in same PDB: d2iwga1, d2iwgb1, d2iwgd1, d2iwge1
   automatically matched to d1hzhh4
   complexed with fu4, gal, man, nag

Details for d2iwga2

PDB Entry: 2iwg, 2.35 Å

PDB Description: complex between the pryspry domain of trim21 and igg fc

PDB Compounds: (A:) ig gamma-1 chain c

SCOP Domain Sequences for d2iwga2:

Sequence; same for both SEQRES and ATOM records:

>d2iwga2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d2iwga2:

• d2iwga2 first appeared in SCOP 1.73
  
• d2iwga2 appears in SCOPe 2.01
  
• d2iwga2 appears in the current release, SCOPe 2.08