| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries) |
| Domain d2iwga2: 2iwg A:340-443 [137753] Other proteins in same PDB: d2iwga1, d2iwgd1 automatically matched to d1hzhh4 complexed with fu4, gal, man, nag |
PDB Entry: 2iwg (more details), 2.35 Å
SCOP Domain Sequences for d2iwga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwga2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d2iwga2: