Lineage for d2iw9b2 (2iw9 B:309-432)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772194Protein Cyclin A [47956] (2 species)
  7. 772195Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries)
  8. 772209Domain d2iw9b2: 2iw9 B:309-432 [137749]
    Other proteins in same PDB: d2iw9a1, d2iw9c1
    automatically matched to d1vin_2
    complexed with 4sp, mg, sgm; mutant

Details for d2iw9b2

PDB Entry: 2iw9 (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
PDB Compounds: (B:) Cyclin-A2

SCOP Domain Sequences for d2iw9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw9b2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOP Domain Coordinates for d2iw9b2:

Click to download the PDB-style file with coordinates for d2iw9b2.
(The format of our PDB-style files is described here.)

Timeline for d2iw9b2: