![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (4 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries) |
![]() | Domain d2iw9b1: 2iw9 B:181-308 [137748] automatically matched to d1vin_1 complexed with 4sp, mg, sgm; mutant |
PDB Entry: 2iw9 (more details), 2 Å
SCOP Domain Sequences for d2iw9b1:
Sequence, based on SEQRES records: (download)
>d2iw9b1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
>d2iw9b1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehlvlkvl tfdlaa
Timeline for d2iw9b1: