Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
Domain d2iw9b1: 2iw9 B:176-309 [137748] Other proteins in same PDB: d2iw9a2, d2iw9a3, d2iw9c2, d2iw9c3 automated match to d1oi9b1 complexed with 4sp, mg, sgm |
PDB Entry: 2iw9 (more details), 2 Å
SCOPe Domain Sequences for d2iw9b1:
Sequence, based on SEQRES records: (download)
>d2iw9b1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
>d2iw9b1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehl vlkvltfdlaap
Timeline for d2iw9b1: