Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
Domain d2iw8d2: 2iw8 D:310-432 [137747] Other proteins in same PDB: d2iw8a1, d2iw8a2, d2iw8c2, d2iw8c3 automated match to d1oiub2 complexed with 4sp, sgm; mutant |
PDB Entry: 2iw8 (more details), 2.3 Å
SCOPe Domain Sequences for d2iw8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw8d2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d2iw8d2: