Class a: All alpha proteins [46456] (258 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (4 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries) |
Domain d2iw8d2: 2iw8 D:309-432 [137747] automatically matched to d1vin_2 complexed with 4sp, sgm; mutant |
PDB Entry: 2iw8 (more details), 2.3 Å
SCOP Domain Sequences for d2iw8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw8d2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe tlnl
Timeline for d2iw8d2: