Lineage for d2iw8d2 (2iw8 D:309-432)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644090Domain d2iw8d2: 2iw8 D:309-432 [137747]
    automatically matched to d1vin_2
    complexed with 4sp, sgm; mutant

Details for d2iw8d2

PDB Entry: 2iw8 (more details), 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor
PDB Compounds: (D:) Cyclin-A2

SCOP Domain Sequences for d2iw8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw8d2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOP Domain Coordinates for d2iw8d2:

Click to download the PDB-style file with coordinates for d2iw8d2.
(The format of our PDB-style files is described here.)

Timeline for d2iw8d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iw8d1