| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries) Uniprot P20248 175-432 |
| Domain d2iw8b2: 2iw8 B:310-432 [137745] Other proteins in same PDB: d2iw8a1, d2iw8c_ automated match to d1oi9b2 complexed with 4sp, sgm; mutant |
PDB Entry: 2iw8 (more details), 2.3 Å
SCOPe Domain Sequences for d2iw8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw8b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl
Timeline for d2iw8b2:
View in 3DDomains from other chains: (mouse over for more information) d2iw8a1, d2iw8c_, d2iw8d1, d2iw8d2 |