Lineage for d2iw8b1 (2iw8 B:176-309)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495418Protein Cyclin A [47956] (2 species)
  7. 1495454Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
    Uniprot P20248 175-432
  8. 1495549Domain d2iw8b1: 2iw8 B:176-309 [137744]
    Other proteins in same PDB: d2iw8a1, d2iw8c_
    automated match to d1oi9b1
    complexed with 4sp, sgm; mutant

Details for d2iw8b1

PDB Entry: 2iw8 (more details), 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d2iw8b1:

Sequence, based on SEQRES records: (download)

>d2iw8b1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

Sequence, based on observed residues (ATOM records): (download)

>d2iw8b1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehl
vlkvltfdlaap

SCOPe Domain Coordinates for d2iw8b1:

Click to download the PDB-style file with coordinates for d2iw8b1.
(The format of our PDB-style files is described here.)

Timeline for d2iw8b1: