SCOPe 2.07: Domain d2iw1a_: 2iw1 A:

Lineage for d2iw1a_ (2iw1 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
   Pfam PF00534

6. Protein Lipopolysaccharide core biosynthesis protein RfaG [142771] (1 species)
   Glucosyltransferase I

7. Species Escherichia coli [TaxId:562] [142772] (2 PDB entries)
   Uniprot P25740 2-371

8. Domain d2iw1a_: 2iw1 A: [137738]
   automated match to d2iv7a1
   complexed with u2f

Details for d2iw1a_

PDB Entry: 2iw1, 1.5 Å

PDB Description: crystal structure of waag, a glycosyltransferase involved in lipopolysaccharide biosynthesis

PDB Compounds: (A:) lipopolysaccharide core biosynthesis protein rfag

SCOPe Domain Sequences for d2iw1a_:

Sequence; same for both SEQRES and ATOM records:

>d2iw1a_ c.87.1.8 (A:) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]}
ivafclykyfpfgglqrdfmriastvaarghhvrvytqswegdcpkafeliqvpvkshtn
hgrnaeyyawvqnhlkehpadrvvgfnkmpgldvyfaadvcyaekvaqekgflyrltsry
rhyaaferatfeqgkstklmmltdkqiadfqkhyqteperfqilppgiypdrkyseqipn
sreiyrqkngikeqqnlllqvgsdfgrkgvdrsiealaslpeslrhntllfvvgqdkprk
fealaeklgvrsnvhffsgrndvselmaaadlllhpayqeaagivlleaitaglpvltta
vcgyahyiadancgtviaepfsqeqlnevlrkaltqsplrmawaenarhyadtqdlyslp
ekaadiitgg

Timeline for d2iw1a_:

• d2iw1a_ first appeared in SCOP 1.73, called d2iw1a1
  
• d2iw1a_ appears in SCOPe 2.06
  
• d2iw1a_ appears in the current release, SCOPe 2.08