SCOPe 2.08: Domain d2iw0a1: 2iw0 A:29-248

Lineage for d2iw0a1 (2iw0 A:29-248)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456

6. Protein Chitin deacetylase [141953] (1 species)

7. Species Bean anthracnose fungus (Colletotrichum lindemuthianum) [TaxId:290576] [141954] (1 PDB entry)
   Uniprot Q6DWK3 29-248

8. Domain d2iw0a1: 2iw0 A:29-248 [137737]
   Other proteins in same PDB: d2iw0a2
   complexed with act, cl, po4, zn

Details for d2iw0a1

PDB Entry: 2iw0, 1.81 Å

PDB Description: structure of the chitin deacetylase from the fungal pathogen colletotrichum lindemuthianum

PDB Compounds: (A:) chitin deacetylase

SCOPe Domain Sequences for d2iw0a1:

Sequence; same for both SEQRES and ATOM records:

>d2iw0a1 c.6.2.3 (A:29-248) Chitin deacetylase {Bean anthracnose fungus (Colletotrichum lindemuthianum) [TaxId: 290576]}
vpvgtpilqctqpglvaltyddgpftftpqlldilkqndvratffvngnnwanieagsnp
dtirrmradghlvgshtyahpdlntlssadrisqmrqleeatrridgfapkymrapylsc
dagcqgdlgglgyhiidtnldtkdyennkpetthlsaekfnnelsadvgansyivlshdv
heqtvvsltqklidtlkskgyravtvgeclgdapenwyka

Timeline for d2iw0a1:

• d2iw0a1 first appeared in SCOP 1.73
  
• d2iw0a1 appears in SCOPe 2.07