SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ivzd2 (2ivz D:35-162)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120781Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2120933Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2120934Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 2120935Protein TolB, N-terminal domain [52966] (1 species)
  7. 2120936Species Escherichia coli [TaxId:562] [52967] (4 PDB entries)
  8. 2120944Domain d2ivzd2: 2ivz D:35-162 [137736]
    Other proteins in same PDB: d2ivza1, d2ivzb1, d2ivzc1, d2ivzd1
    automatically matched to d1crza2
    complexed with ca

Details for d2ivzd2

PDB Entry: 2ivz (more details), 2 Å

PDB Description: structure of tolb in complex with a peptide of the colicin e9 t-domain
PDB Compounds: (D:) protein tolb

SCOPe Domain Sequences for d2ivzd2:

Sequence, based on SEQRES records: (download)

>d2ivzd2 c.51.2.1 (D:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
ekltgikg

Sequence, based on observed residues (ATOM records): (download)

>d2ivzd2 c.51.2.1 (D:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]}
grpigvvpfqwagapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgi
davvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekl
tgikg

SCOPe Domain Coordinates for d2ivzd2:

Click to download the PDB-style file with coordinates for d2ivzd2.
(The format of our PDB-style files is described here.)

Timeline for d2ivzd2: