![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family) ![]() |
![]() | Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein) |
![]() | Protein TolB, N-terminal domain [52966] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52967] (4 PDB entries) |
![]() | Domain d2ivzb2: 2ivz B:35-162 [137732] Other proteins in same PDB: d2ivza1, d2ivzb1, d2ivzc1, d2ivzd1 automatically matched to d1crza2 complexed with ca |
PDB Entry: 2ivz (more details), 2 Å
SCOP Domain Sequences for d2ivzb2:
Sequence, based on SEQRES records: (download)
>d2ivzb2 c.51.2.1 (B:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]} grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf ekltgikg
>d2ivzb2 c.51.2.1 (B:35-162) TolB, N-terminal domain {Escherichia coli [TaxId: 562]} grpigvvpfqwapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgida vvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekltg ikg
Timeline for d2ivzb2: