Lineage for d2ivzb1 (2ivz B:163-431)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417861Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) (S)
  5. 2417862Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)
  6. 2417863Protein TolB, C-terminal domain [50962] (1 species)
  7. 2417864Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. 2417870Domain d2ivzb1: 2ivz B:163-431 [137731]
    Other proteins in same PDB: d2ivza2, d2ivzb2, d2ivzc2, d2ivzd2
    automatically matched to d1c5ka1
    complexed with ca

Details for d2ivzb1

PDB Entry: 2ivz (more details), 2 Å

PDB Description: structure of tolb in complex with a peptide of the colicin e9 t-domain
PDB Compounds: (B:) protein tolb

SCOPe Domain Sequences for d2ivzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivzb1 b.68.4.1 (B:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOPe Domain Coordinates for d2ivzb1:

Click to download the PDB-style file with coordinates for d2ivzb1.
(The format of our PDB-style files is described here.)

Timeline for d2ivzb1: