Lineage for d2ivza1 (2ivz A:163-431)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 675133Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) (S)
  5. 675134Family b.68.4.1: TolB, C-terminal domain [50961] (1 protein)
  6. 675135Protein TolB, C-terminal domain [50962] (1 species)
  7. 675136Species Escherichia coli [TaxId:562] [50963] (4 PDB entries)
  8. 675141Domain d2ivza1: 2ivz A:163-431 [137729]
    Other proteins in same PDB: d2ivza2, d2ivzb2, d2ivzc2, d2ivzd2
    automatically matched to d1c5ka1
    complexed with ca

Details for d2ivza1

PDB Entry: 2ivz (more details), 2 Å

PDB Description: structure of tolb in complex with a peptide of the colicin e9 t-domain
PDB Compounds: (A:) protein tolb

SCOP Domain Sequences for d2ivza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivza1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOP Domain Coordinates for d2ivza1:

Click to download the PDB-style file with coordinates for d2ivza1.
(The format of our PDB-style files is described here.)

Timeline for d2ivza1: