SCOPe 2.07: Domain d2ivkb_: 2ivk B:

Lineage for d2ivkb_ (2ivk B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.6: Endonuclease I [102726] (2 proteins)
   automatically mapped to Pfam PF04231

6. Protein automated matches [190330] (3 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:672] [187152] (1 PDB entry)

8. Domain d2ivkb_: 2ivk B: [137726]
   automated match to d1oupa_
   protein/DNA complex

Details for d2ivkb_

PDB Entry: 2ivk, 2.9 Å

PDB Description: crystal structure of the periplasmic endonuclease vvn complexed with a 16-bp dna

PDB Compounds: (B:) endonuclease I

SCOPe Domain Sequences for d2ivkb_:

Sequence; same for both SEQRES and ATOM records:

>d2ivkb_ d.4.1.6 (B:) automated matches {Vibrio vulnificus [TaxId: 672]}
appssfsaakqqavkiyqdhpisfycgcdiewqgkkgipnletcgyqvrkqqtrasriew
eavvpawqfghhrqcwqkggrkncskndqqfrlmeadlhnltpaigevngdrsnfnfsqw
ngvdgvsygrcemqvnfkqrkvmppdrargsiartylymsqeygfqlskqqqqlmqawnk
sypvdewectrddriakiqgnhnpfvqqscqtq

Timeline for d2ivkb_:

• d2ivkb_ first appeared in SCOP 1.73, called d2ivkb1
  
• d2ivkb_ appears in SCOPe 2.06
  
• d2ivkb_ appears in the current release, SCOPe 2.08