Lineage for d2ivkb_ (2ivk B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927968Family d.4.1.6: Endonuclease I [102726] (2 proteins)
    automatically mapped to Pfam PF04231
  6. 2927974Protein automated matches [190330] (3 species)
    not a true protein
  7. 2927981Species Vibrio vulnificus [TaxId:672] [187152] (1 PDB entry)
  8. 2927983Domain d2ivkb_: 2ivk B: [137726]
    automated match to d1oupa_
    protein/DNA complex

Details for d2ivkb_

PDB Entry: 2ivk (more details), 2.9 Å

PDB Description: crystal structure of the periplasmic endonuclease vvn complexed with a 16-bp dna
PDB Compounds: (B:) endonuclease I

SCOPe Domain Sequences for d2ivkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivkb_ d.4.1.6 (B:) automated matches {Vibrio vulnificus [TaxId: 672]}
appssfsaakqqavkiyqdhpisfycgcdiewqgkkgipnletcgyqvrkqqtrasriew
eavvpawqfghhrqcwqkggrkncskndqqfrlmeadlhnltpaigevngdrsnfnfsqw
ngvdgvsygrcemqvnfkqrkvmppdrargsiartylymsqeygfqlskqqqqlmqawnk
sypvdewectrddriakiqgnhnpfvqqscqtq

SCOPe Domain Coordinates for d2ivkb_:

Click to download the PDB-style file with coordinates for d2ivkb_.
(The format of our PDB-style files is described here.)

Timeline for d2ivkb_: